PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01018021001
Common NameVIT_05s0020g03880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CPP
Protein Properties Length: 718aa    MW: 78369.7 Da    PI: 6.65
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01018021001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.34.9e-16422459340
                TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        +k+CnCkkskClk+YCeCfaag++C e C+C++C+Nk 
  GSVIVT01018021001 422 CKRCNCKKSKCLKLYCECFAAGVYCVEPCSCQECFNKP 459
                        89**********************************96 PP

2TCR50.63.9e-16506544139
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                        ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  GSVIVT01018021001 506 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNA 544
                        589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.8E-16420461IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.117421546IPR005172CRC domain
PfamPF036381.2E-11423458IPR005172CRC domain
SMARTSM011142.9E-17506547IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-11508544IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MDTPERNQIA APISKFEDSP VFNFINSLSP IKPVKSAHIA QTFNSLSFVS LPSIFTSPHV  60
SSHKESRFLR RHNFSDPSKP EFSSVNGNKV STNEEVMDAD HPDCDPTPCG GMCQIEQKKE  120
EAGCDWESLI SDAADLLIFD SPDDTRAFKG LIQKSLDPGT SVCASLGSQF SQDDVSDLQK  180
KQFVGSDDSG EHETDDPSTQ PEEASKLNGM DQKQENLANT SFKDCMGSNA SGEMDNEGGT  240
SIPVPSKTLS NLHRGMRRRC LVFEMAGVRR KNMDDGSNCS SSMLSQSDGT FVPNDKQLVP  300
LKPGNDSSRR ILPGIGLHLN ALATTSKDYN IVKHETLTSG RQLISVPSSS GSYLSTIEGQ  360
EPVNKSLALN SSDRETDPAE NGFQALEDAS QASAYAISEE LNQSSPKKKR RRLEHGGETE  420
GCKRCNCKKS KCLKLYCECF AAGVYCVEPC SCQECFNKPI HEDTVLATRK QIESRNPLAF  480
APKVIRSSDS LPEVGDEPSK TPASARHKRG CNCKKSSCLK KYCECYQGGV GCSINCRCEG  540
CKNAFGRKDG SALIGMEAEL EEETETLEKS VVDKNLQKSI VQNDEEYLDS ALPVTPLRTC  600
RQPSQLSFPS KTKLPRSSFL TIGSSSGLHT SQIFGKPNFP QPQSKFEKKF QTIPEDEMPE  660
ILRGNCSPTS SSIKTASPNS KRVSPPHCDF GSSPSRRSGR KLILQSIPSF PSLTPQH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405412PKKKRRRL
2406411KKKRRR
3408412KRRRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.82620.0bud| fruit| inflorescence
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3811450.0FQ381145.1 Vitis vinifera clone SS0ACG1YE14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010649949.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLF6HDS90.0F6HDS9_VITVI; Putative uncharacterized protein
STRINGVIT_05s0020g03880.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-161TESMIN/TSO1-like CXC 2